SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386039323|ref|YP_005958277.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039323|ref|YP_005958277.1|
Domain Number 1 Region: 629-797
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 3-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0015
Further Details:      
 
Domain Number 3 Region: 143-307
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.74e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0014
Further Details:      
 
Domain Number 4 Region: 518-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.36e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039323|ref|YP_005958277.1|
Sequence length 809
Comment nitrite reductase (NAD(P)H) large subunit [Paenibacillus polymyxa M1]
Sequence
MINSKKKLVVIGNGMAGINTVEQILKLTDKYEITVLGSEPHPNYNRIMLSYVLEGSKTID
DIILNDLQWYADQGITLYTGKMVKSIDGEHKKILTEDGLEIDYDVALVATGSQSFILPIP
GKELPGVIGFRDIADCSAMLEAAKTYKKAAVIGGGLLGLEAAKGLVNLGMDVTVVHLMED
LMERQLDREASAMLKAELERQGIKFAMQMQTAEVYGQDRVQGLRFSDGSELEADLVVMAV
GIKPNIQVAKESDMETNRGIVVDDFMRTSMPDVYAVGECVEHRGICYGLVAPLFEQGSVI
AKHLAGVDTEGYAGSVVSTKLKISGVDVFSAGEFITQPEHTAIVAKDEWKRTYKKVLLRD
NKIVGTVLFGDVSESASLQKYVRQQTEMTDEIYGQIMGTGCGNHGAKTSSVETMADDEIV
CGCNGVTKKAIVEAINENGLTTVDEIKACTGATRSCGGCKPVVEQILQYVLGDSFKTSAK
QGICGCTTLSRDEIVEAIKTKGLTTTREVMNVLGWHNDEGCSKCRPALNYYLGMINPDTY
ENEGDSRFVNERLHANIQKDGTFTVVPRMYGGVTTPEDLKKIADVSLKYNVKVVKVTGGQ
RLDLIGVRKEDLPKVWEELDMPSGYAYAKSLRTVKTCVGSQFCRFGTQDSMGMGEVLERK
FERLDFPAKFKLAVNGCPRNCAESCTKDIGIVGNDGGWEIFIGGNGGIKARLADSLCKVK
TDAELIDIVGAVMQFYRETGQYLERTSEWVERIGLEEIQKAVVNDTANRQALVERVEFAL
QQVEDPWKKIIHDEDTRKNLFEAVTPSIV
Download sequence
Identical sequences E3EGM6
gi|310640148|ref|YP_003944906.1| WP_013369302.1.14980 WP_013369302.1.91857 gi|386039323|ref|YP_005958277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]