SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386041901|ref|YP_005960855.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041901|ref|YP_005960855.1|
Domain Number 1 Region: 117-298,422-582
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000772
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily GAD domain-like 2.29e-32
Family GAD domain 0.00058
Further Details:      
 
Domain Number 3 Region: 4-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.62e-28
Family Anticodon-binding domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386041901|ref|YP_005960855.1|
Sequence length 589
Comment aspartyl-tRNA synthetase [Paenibacillus polymyxa M1]
Sequence
MHRYRTHNCGELDQTHVGEIVRIAGWIKNIRNLGGIVFIDLRDHYGVTQIVVSDSNELKD
FVSKISRESTISVIGAVCHRSESTISPHMKTGYIEVVAKEIEVLGKVINPLPFEVSSAHE
AREDLRLKYRFLDLRNENLHDNIVLRSRVIQSIRKKMIDLDFLEIQTPILTSSSPEGARD
YLVPSRVHPGQFYALPQAPQQFKQLLMVSGFDKYFQIAPCFRDEDARADRSPGEFYQLDL
EMAFATQEDVFNVVENMLYEVFSEFTNYKISKPFSRIPYQEAMLKYGSDKPDLRNPLIIH
DVTELFTETDFKVFKNKTIRVIATPGCGGQPRSFYDDIVNFAMEAGAKGLSWIKFNDDMS
LSGSIAKFIPEKVKNELMNVTQAGPGYALFFAADELKNVEKIAGAVRSQLGKRLDLLEKD
TFKFCWIVDFPMFELDPDTHKIEFSHNPFSMPQGGMDALLNMNPLDILAYQYDIVCNGIE
LSSGAVRNHDTEIMVKAFEIAGYTYEEIKSRFPALFNAFQFGPPPHAGIAPGIDRIVMIL
ANESNIREVIAFPMNSKAQDVLMGAPSEVTDKQLRDVNIKLANAQPQTE
Download sequence
Identical sequences E3E969
WP_014600045.1.14980 WP_014600045.1.91857 gi|386041901|ref|YP_005960855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]