SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716316|ref|YP_008048925.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716316|ref|YP_008048925.1|
Domain Number 1 Region: 171-566
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6e-100
Family beta-Lactamase/D-ala carboxypeptidase 0.0000383
Further Details:      
 
Domain Number 2 Region: 51-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.14e-45
Family Penicillin binding protein dimerisation domain 0.0007
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507716316|ref|YP_008048925.1|
Sequence length 638
Comment Stage V sporulation protein D [Paenibacillus polymyxa M1]
Sequence
MKKSNVIMRRRLVWGLLGLFVLFAALSIRLAYVQLGKGGELSAKAEDSWRRNIPFAAKRG
EILDRQGTALTYNVSSPTVMAIPVQIKEPEETARRLAPLLDMSEDKVLKLITKRTASQKL
QPGGRKITMEKAQKIRDLKLPGIVVAEDNKRYYPYGDLAAHILGFTGIDNQGLTGVEKQQ
NSKLRGIDGSIAYLSDAGGRLMPGSSEKYIEPKDGLNLQLTIDKSVQSIMERELDQAMVK
FQAKSALSIAMNPKTGEILGMAGRPSYEPALYKQYAPEIYNRNLPIWMTYEPGSTFKIIT
LAAALEEKKVNLKNDRFFDPGYIEVGGARLRCWKKGGHGSQTFLQVVENSCNPGFVTLGQ
RLGKETLFKYIRNFGFGSKTGIDMIGEGNGILFKLAQVGPVELATTAFGQGVSVTPIQQV
TAVSAAINGGNLYKPHITKGWIQPETGKVLEKVEPELVRRVVSEDTSRQVREALESVVAK
GTGRPAFIEGYRVGGKTGTAQKVINGRYSSSEHIVSFIGFAPADDPQIVVYTAVDNPKGI
QFGGVVAAPIVQNILKDALIALKIPPRTNQIAKEYKYGEKPIETVPDLVGATAADLYEDM
NMNFMLVKSGSGKTVISQAPKPGSRLERGSTIRIYMGD
Download sequence
Identical sequences E3E8G1
gi|507716316|ref|YP_008048925.1| gi|310642993|ref|YP_003947751.1| WP_013372095.1.14980 WP_013372095.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]