SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716450|ref|YP_008049059.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|507716450|ref|YP_008049059.1|
Domain Number - Region: 121-268
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00615
Family DNA repair protein MutS, domain III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507716450|ref|YP_008049059.1|
Sequence length 276
Comment hypothetical protein PPM_3495 [Paenibacillus polymyxa M1]
Sequence
MNIPERFIKRFPAYEDVFASDLEHHRKHFLPICSINLQFLFPEQDEWLHFVSVKEIHEGC
VGENTQQFHTLYTKEDMLGFDVIDGKYKFEADWNYFSLHQKAQLEATYEALKSTGDKAYL
RMKREVMALDGLEQVYTANEQDYEARKAFFLENNKIYPYSSFGEAKKSVEELTHDFEEKQ
SSGWGLSFPEVNGILDDIAFQSDEAQSYIKEYDESLEEMLKFEQTNLLHVPKRTNGETFT
YIGSFTGYYFQAFGADTVYLFYDRELKKAVICFEYS
Download sequence
Identical sequences E3E5E2
gi|507716450|ref|YP_008049059.1| gi|310643144|ref|YP_003947902.1| WP_013372242.1.13814 WP_013372242.1.14980 WP_013372242.1.57060 WP_013372242.1.91857 WP_013372242.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]