SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716590|ref|YP_008049199.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716590|ref|YP_008049199.1|
Domain Number 1 Region: 159-290
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 7.85e-23
Family Cell-division protein ZipA, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507716590|ref|YP_008049199.1|
Sequence length 308
Comment zipA-like cell division protein [Paenibacillus polymyxa M1]
Sequence
MILPEYGSEDVSSILAVELDHGSRKTIKGVHEVEPDSNIYWLIDVEFNGFTLSDEDILQL
LKGYIVYGHVQDLQIWTSVGRRLEGECRYDKICICVDIFNNVEMQICLEEAKVADFMNTL
PARFQEKGTIRVLPREDAAHARAKAEKLQAFTDQEGEREHFVMLRLVADQGQSYRGADIW
DVMLSLGMKWGDMDIFHAHHHGPGGNDELFSVHTGTEPGFFWLSTLAEERFADLIFSMDV
VRTVQPQAVFEAMWKSAEYARARLGGTLVNEQDLPAVPEDYLCQIQEMEDRLSEFGFKAG
EYTVAFLL
Download sequence
Identical sequences E3E9M8
gi|507716590|ref|YP_008049199.1| gi|310643301|ref|YP_003948059.1| WP_013372398.1.14980 WP_013372398.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]