SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507716820|ref|YP_008049429.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716820|ref|YP_008049429.1|
Domain Number 1 Region: 63-131
Classification Level Classification E-value
Superfamily RuvA domain 2-like 4.95e-20
Family DNA helicase RuvA subunit, middle domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000154
Family DNA helicase RuvA subunit, N-terminal domain 0.0056
Further Details:      
 
Domain Number 3 Region: 153-201
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.000000798
Family DNA helicase RuvA subunit, C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507716820|ref|YP_008049429.1|
Sequence length 204
Comment Holliday junction ATP-dependent DNA helicase ruvA [Paenibacillus polymyxa M1]
Sequence
MIDFLRGSVAHLENEYVVLDVQGVGYRVFCPNPYAFAKTEGPVVIYTHHHVREDAILLFG
FATREEQQLFRKLIDVSGIGPRVALGILGGGTPAHVVTAIYQENITFLTKLPGIGKKTAQ
RMILDLKDKLDGIGALGMATGLFAEPAVEEGQGSYWSEAREALKALGYTDAELDKVWSKM
KKDAKPDDSADILMKRALQLLFAG
Download sequence
Identical sequences E3E8X8
WP_013372651.1.14980 WP_013372651.1.91857 gi|507716820|ref|YP_008049429.1| gi|310643559|ref|YP_003948317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]