SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717468|ref|YP_008050077.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717468|ref|YP_008050077.1|
Domain Number 1 Region: 136-293
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.4e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000323
Further Details:      
 
Domain Number 2 Region: 390-534
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 10-135
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.45e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.00027
Further Details:      
 
Domain Number 4 Region: 271-402
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.2e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507717468|ref|YP_008050077.1|
Sequence length 541
Comment ferredoxin-nitrite reductase [Paenibacillus polymyxa M1]
Sequence
MAYEPIWNAHPDKLNKFELVKLEKDGLDVIRTIIESYAHKGYDSITADDMDRFKWAGVYQ
QKPKDGHFMMRVRINTGIMTSAQARALADISALYGRGLVDVTTRQAIQFHWLTVESLPDI
FERLEKVGLYSFEACGDCPRTIVGNPLAGIDPNELVDTQEIVDEVNRFFLLNRDFSNLPR
KYKMSISSNTYNNAQAEINDLSFTPATKILDGKEVVGFHVMVGGGLSAKPHLAHPLDLFV
RPEEVLKVAIAVTTIFRDYGYREKRHHARLKFLIADWGPDKFLAKLTEYTGEMPGRGEDK
TIGWQAAYFDGIHPQAQEGLNYVGLNVPVGRLSANELHELADLADRYGDGQIRTTMSQNI
LLSGVPDDQVDELLKAPVLQRLTPQPKHFMSRTVSCTGNEFCNLAIVETKKRAVDVAEYL
DQHVQLDEKVRIHFIGCPNSCGQKHIADIGLQGSLLKTPEGMVDAFDIAVGGALGAGAQF
NKTLKGRVRGDQVGPVLAELILFYKENRIAGESFYAYVQRVGIPSFQEKLSAILQSSHVA
S
Download sequence
Identical sequences E3EAM2
gi|310644262|ref|YP_003949021.1| gi|507717468|ref|YP_008050077.1| WP_013373319.1.13814 WP_013373319.1.14980 WP_013373319.1.31500 WP_013373319.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]