SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717502|ref|YP_008050111.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717502|ref|YP_008050111.1|
Domain Number 1 Region: 17-404
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.14e-138
Family ArgJ-like 0.000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507717502|ref|YP_008050111.1|
Sequence length 408
Comment glutamate N-acetyltransferase / amino-acid N-acetyltransferase [Paenibacillus polymyxa M1]
Sequence
MGKVGFTVVHEGNIVTPRGFTAGGLHCGLKNTNRNDIGAIRCEVEATAAAVYTTNVFQAA
PLKVTRESLTDGRLQAIVVNSGNANACTGQQGEQDAYAMRSAAAHQLGVAESDVAVASTG
VIGEHLKMDRVLGGISSLPERMSEASDGAEQFSQAILTTDLVKKEACVSVEVDGVTVHIA
GAAKGSGMIHPNMATMLAFITCDAVIGQTALHQLLKQATDTSFNMITVDGDTSTNDMLIA
MASGLAGNSELHTDHPDWEAFAEAFTYICRELAKAIARDGEGATKLVEVSVSGAISDASA
QAIAKTVIGSSLVKSAVFGADANWGRIIAAVGRAGEPVNPDTVDIRLGDIIVLSQSSPVA
FDEAEALSYLRGDTVQIIVDLHHGNGTATAWGCDLTYDYVRINAAYRT
Download sequence
Identical sequences E3EBK6
WP_013373362.1.14980 WP_013373362.1.91857 gi|310644306|ref|YP_003949065.1| gi|507717502|ref|YP_008050111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]