SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717530|ref|YP_008050139.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717530|ref|YP_008050139.1|
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000000654
Family FlgN-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507717530|ref|YP_008050139.1|
Sequence length 166
Comment putative protein yvyG [Paenibacillus polymyxa M1]
Sequence
MPLERLIGVLEQLDQKHLILLELAKSKKKIVMENDMDSLVQHLNQESRLLKQVEQLEEAR
MEVSYELLRERGIKSQLNLTITELARLVFDPEDKNKLLSVQSRLSHTLSELKEINEINQK
LIEQSLVFIDYSLDLLVGRPNQEMTYMHPDQKSNQHARPGLFDTKA
Download sequence
Identical sequences E3EBN5
gi|507717530|ref|YP_008050139.1| gi|310644335|ref|YP_003949094.1| WP_013373391.1.14980 WP_013373391.1.21650 WP_013373391.1.40264 WP_013373391.1.6267 WP_013373391.1.88866 WP_013373391.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]