SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386038953|ref|YP_005957907.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386038953|ref|YP_005957907.1|
Domain Number 1 Region: 91-157
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000000542
Family Sigma4 domain 0.013
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0000000000000184
Family Sigma2 domain of RNA polymerase sigma factors 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386038953|ref|YP_005957907.1|
Sequence length 172
Comment RNA polymerase sigma factor sigW Sigma-W factor [Paenibacillus polymyxa M1]
Sequence
MTDRELFELYKEQIYYFCYYLMQNQADAEDVCQEVFVKAILADRSKVQDLKSWILRIASN
ECSNVLRRRKTGLMKEIRTFLLSRPHSFNPVEESLYHRETKTELHQLYNKLPDKIRMVVV
LRYVNELTVPEISRVINIPEGTAKSRLNRGLKLLKKMVVSQVKEMNSSESVF
Download sequence
Identical sequences E3ECC6
gi|310639752|ref|YP_003944510.1| WP_013368911.1.13814 WP_013368911.1.14980 WP_013368911.1.57060 WP_013368911.1.6267 WP_013368911.1.91857 WP_013368911.1.99789 gi|386038953|ref|YP_005957907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]