SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386041578|ref|YP_005960532.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041578|ref|YP_005960532.1|
Domain Number 1 Region: 30-134
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.35e-26
Family Sigma2 domain of RNA polymerase sigma factors 0.00074
Further Details:      
 
Domain Number 2 Region: 138-205
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000000000000766
Family Sigma4 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386041578|ref|YP_005960532.1|
Sequence length 210
Comment RNA polymerase sigma factor rpoD Sigma-42 [Paenibacillus polymyxa M1]
Sequence
MSFLNFFFEICRGRKIPGVYSIGKGESVIDIERIIERIRSGDRQAFREIVELYSKHVFHV
AYSVLHDSKEAEDAAQEAFVQVYKSLPQYRNEGFKTWLSRIALHKALDIKRKQDRRPAEL
IDVAQSLVQLPSPDEDVLARLIREEQTVELSQKIAQLPQQHRDIIQAYYMQGKTYDQIAE
ETQVALKTVESRLYRARLWIRNHWKEEEWQ
Download sequence
Identical sequences E3E4Q0
gi|386041578|ref|YP_005960532.1| WP_013371627.1.13814 WP_013371627.1.14980 WP_013371627.1.31500 WP_013371627.1.91857 gi|310642511|ref|YP_003947269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]