SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386041611|ref|YP_005960565.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041611|ref|YP_005960565.1|
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.16e-24
Family Sigma2 domain of RNA polymerase sigma factors 0.0007
Further Details:      
 
Domain Number 2 Region: 118-181
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.62e-16
Family Sigma4 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386041611|ref|YP_005960565.1|
Sequence length 198
Comment RNA polymerase sigma factor sigW Sigma-W factor [Paenibacillus polymyxa M1]
Sequence
MMTDSQMIQEIKQGNVEVYSELMRRHQRKILAFVYHMLKSSNLEMIAEDLCSETFYKAYR
SLHSFREVDASFSTWLYTIARNTVLSELRKHRSGQVPLEESGYVPVAPSDVIPEQAVLRG
EKVEMVREAINRLPEKQRSALILREYEQLDYQEIATILGQTVSAVKSLLFRARTSVKTQL
EPYFFEPLYEENEGMSSQ
Download sequence
Identical sequences A0A074LE00 E0RCI7
gi|386041611|ref|YP_005960565.1| gi|308069492|ref|YP_003871097.1| gi|310642545|ref|YP_003947303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]