SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716303|ref|YP_008048912.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716303|ref|YP_008048912.1|
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.96e-34
Family Sigma2 domain of RNA polymerase sigma factors 0.00095
Further Details:      
 
Domain Number 2 Region: 150-244
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.27e-23
Family Sigma4 domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507716303|ref|YP_008048912.1|
Sequence length 246
Comment RNA polymerase sigma-E factor [Paenibacillus polymyxa M1]
Sequence
MREQMNLKMKFRLAWQLQYYRILFLFGLKSEEIYYIGGSEALPPPLTRDEEEYLLGKLSS
GDAAVRSMLIERNLRLVVYIARKFENTGINIEDLVSIGAIGLIKAVNTFDPEKKIKLATY
ASRCIENEILMYLRRNSKTRTEVSFDEPLNIDWDGNELLLSDVMGTENDTIYRNIEEQVD
RKLLHKALDKLTDRERLIMELRFGLQDGEEKTQKDVADLLGISQSYISRLEKRIIKRLRK
EFNKMV
Download sequence
Identical sequences A0A0F0G658 E3E8E7
WP_013372081.1.13814 WP_013372081.1.14980 WP_013372081.1.15730 WP_013372081.1.16985 WP_013372081.1.21650 WP_013372081.1.29540 WP_013372081.1.31500 WP_013372081.1.36933 WP_013372081.1.41886 WP_013372081.1.57060 WP_013372081.1.6267 WP_013372081.1.71998 WP_013372081.1.78809 WP_013372081.1.88866 WP_013372081.1.91857 WP_013372081.1.99789 gi|310642979|ref|YP_003947737.1| gi|507716303|ref|YP_008048912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]