SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716348|ref|YP_008048957.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716348|ref|YP_008048957.1|
Domain Number 1 Region: 105-214
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.96e-54
Family Sigma2 domain of RNA polymerase sigma factors 0.0000146
Further Details:      
 
Domain Number 2 Region: 274-375
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 7.29e-30
Family Sigma4 domain 0.00014
Further Details:      
 
Domain Number 3 Region: 217-290
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.66e-24
Family Sigma3 domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507716348|ref|YP_008048957.1|
Sequence length 377
Comment RNA polymerase sigma factor rpoD [Paenibacillus polymyxa M1]
Sequence
MANDQHTELETELTLDQVKDQLIELGKKSSSLNYKDIMEKLSPFDQDPEQMDEFYEQLGD
LGIEVVNDNDEEVTRLRQNDDPENNDGDDFNFDDDLSLPPGIKINDPVRMYLKEIGRVPL
LSADDEVELAKRINNGDEEAKRRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKA
VEKFDYEKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVSRQLLQELG
REPTPEEVAAEMELSVEKVREIMKIAQEPVSLETPIGEEDDSHLGDFIEDQEALAPADAA
AYELLKEQLEDVLDTLTEREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKAL
RKLRHPSRSKRLKDFLE
Download sequence
Identical sequences A0A074LB87 A0A0K2FBE8 A0A163U967 A0A222WJR7 A0A2K1EGQ9 E0RHD3 E3E8J9 H6CKK4
WP_007431230.1.1198 WP_007431230.1.12882 WP_007431230.1.13814 WP_007431230.1.14980 WP_007431230.1.15730 WP_007431230.1.16985 WP_007431230.1.1883 WP_007431230.1.21208 WP_007431230.1.21650 WP_007431230.1.26652 WP_007431230.1.29540 WP_007431230.1.30741 WP_007431230.1.31500 WP_007431230.1.36933 WP_007431230.1.37152 WP_007431230.1.40264 WP_007431230.1.41886 WP_007431230.1.44575 WP_007431230.1.44658 WP_007431230.1.51576 WP_007431230.1.57060 WP_007431230.1.59813 WP_007431230.1.6267 WP_007431230.1.6878 WP_007431230.1.6981 WP_007431230.1.70359 WP_007431230.1.71998 WP_007431230.1.74614 WP_007431230.1.77953 WP_007431230.1.78023 WP_007431230.1.78517 WP_007431230.1.78774 WP_007431230.1.78809 WP_007431230.1.82066 WP_007431230.1.83942 WP_007431230.1.85813 WP_007431230.1.87280 WP_007431230.1.88866 WP_007431230.1.90060 WP_007431230.1.91807 WP_007431230.1.91857 WP_007431230.1.92362 WP_007431230.1.94972 WP_007431230.1.99789 gi|565993161|ref|YP_008912958.1| gi|310643031|ref|YP_003947789.1| gi|308069922|ref|YP_003871527.1| gi|507716348|ref|YP_008048957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]