SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716401|ref|YP_008049010.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716401|ref|YP_008049010.1|
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.69e-24
Family Sigma2 domain of RNA polymerase sigma factors 0.002
Further Details:      
 
Domain Number 2 Region: 111-173
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.55e-18
Family Sigma4 domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507716401|ref|YP_008049010.1|
Sequence length 182
Comment RNA polymerase sigma-E factor Sigma-24 [Paenibacillus polymyxa M1]
Sequence
MVEQGLIRAAQSGDRDALITLLREIEQHVYRTAYYILNNEQDAMDASQEALIRIYSKINS
YEEKAQFKTWVQRIVTNICIDKFRRTKPSVSIDEHDMIFNDPQNVEVEVLTSYMAQDVRE
AIQQLPEHHRTVIVLRYLQDFSYNEIADSLDLPLNTVKSYLYRARQQLQGLLQEYQKGGV
SG
Download sequence
Identical sequences A0A074LF69 A0A1R1E4J9 A0A2K1EGM9 E0RI64 E3E9H7
WP_013311184.1.1198 WP_013311184.1.13814 WP_013311184.1.14980 WP_013311184.1.15730 WP_013311184.1.16985 WP_013311184.1.21650 WP_013311184.1.26652 WP_013311184.1.29540 WP_013311184.1.36933 WP_013311184.1.37152 WP_013311184.1.41886 WP_013311184.1.44658 WP_013311184.1.51576 WP_013311184.1.57060 WP_013311184.1.6267 WP_013311184.1.71998 WP_013311184.1.74614 WP_013311184.1.78023 WP_013311184.1.78774 WP_013311184.1.78809 WP_013311184.1.85813 WP_013311184.1.87280 WP_013311184.1.88866 WP_013311184.1.91807 WP_013311184.1.91857 WP_013311184.1.94972 WP_013311184.1.99789 gi|310643091|ref|YP_003947849.1| gi|308069979|ref|YP_003871584.1| gi|507716401|ref|YP_008049010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]