SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507716435|ref|YP_008049044.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716435|ref|YP_008049044.1|
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.71e-33
Family Sigma2 domain of RNA polymerase sigma factors 0.0012
Further Details:      
 
Domain Number 2 Region: 137-229
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 3.36e-18
Family Sigma4 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507716435|ref|YP_008049044.1|
Sequence length 233
Comment RNA polymerase sigma factor rpoD Sigma-42 [Paenibacillus polymyxa M1]
Sequence
MPGLFSAIALFIKELTLLVSYVKNNAFPQPLTEKEEARHLKLFAEGNAHSRNTLIEHNLR
LVAHIVKKFDNTGEDLEDLISIGTIGLIKAIESFQTGKGTKLATFAARCIENEILMHLRS
LKKTRKDVSLHDPIGTDKEGNEITLIDILGSEADDIVDKVQLKIEKSKIYRNLDILDERE
KEVVIGRFGLEAGGEERTQREIARELGISRSYVSRIEKRALMKLYHEFYKQKG
Download sequence
Identical sequences A0A163U759 A0A1A0G3U0 E3E9L2
WP_013372224.1.13814 WP_013372224.1.14980 WP_013372224.1.21650 WP_013372224.1.30741 WP_013372224.1.31500 WP_013372224.1.40264 WP_013372224.1.41886 WP_013372224.1.6267 WP_013372224.1.6878 WP_013372224.1.71998 WP_013372224.1.91857 WP_013372224.1.99789 gi|507716435|ref|YP_008049044.1| gi|310643126|ref|YP_003947884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]