SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717365|ref|YP_008049974.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717365|ref|YP_008049974.1|
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.27e-34
Family Sigma2 domain of RNA polymerase sigma factors 0.00064
Further Details:      
 
Domain Number 2 Region: 117-185
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.43e-17
Family Sigma4 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507717365|ref|YP_008049974.1|
Sequence length 188
Comment RNA polymerase sigma factor sigW Sigma-W factor [Paenibacillus polymyxa M1]
Sequence
MDNMESRLVRLVQKGDQRAFAELVELYKDRIFHLSYRMLGNRHEAEDLVQETFLRVYRNL
EKYDHGQKFSTWIYRIATNLCIDRLRRRKPTYSLDAEMNDQEGVDGYAMLASEELTPEGS
TLLSETQALIHDAIDSLPDKYKTIMVLRYLQELSLQEISDVLNLPVTTIKTRVHRGRDFL
RKKLEHKL
Download sequence
Identical sequences A0A0F0G2J7 E3EBJ9
gi|507717365|ref|YP_008049974.1| gi|310644156|ref|YP_003948914.1| WP_013373239.1.13814 WP_013373239.1.14980 WP_013373239.1.15730 WP_013373239.1.16985 WP_013373239.1.29540 WP_013373239.1.31500 WP_013373239.1.36933 WP_013373239.1.41886 WP_013373239.1.57060 WP_013373239.1.6267 WP_013373239.1.71998 WP_013373239.1.78809 WP_013373239.1.88866 WP_013373239.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]