SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717424|ref|YP_008050033.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717424|ref|YP_008050033.1|
Domain Number 1 Region: 13-105
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.44e-21
Family Sigma2 domain of RNA polymerase sigma factors 0.0019
Further Details:      
 
Domain Number 2 Region: 123-210
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000432
Family Sigma4 domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507717424|ref|YP_008050033.1|
Sequence length 214
Comment RNA polymerase sporulation-specific sigma factor [Paenibacillus polymyxa M1]
Sequence
MSVDLKDIMLSKFDYKNDEDIVGAVHEGDGEALEFLINKYRNFVRAKARSYFLIGADRED
IIQEGMIGLYKSIRDFKGDKLASFKAFAELCITRQIITAIKTATRQKHIPLNSYVSLDKP
IYDEESDRTLLDVICGTQVSDPEELIINQEEFVGLEDKMSEILSELERKVLMLYLDGRSY
QEIAEDLDRHVKSIDNALQRVKRKLEKYLEVRDS
Download sequence
Identical sequences A0A074LQU0 A0A0K2FDW9 A0A0S2S6M6 A0A163TK96 A0A2K1ED76 E0RGQ0 E3E738
gi|507717424|ref|YP_008050033.1| gi|565994249|ref|YP_008914186.1| WP_016324748.1.1198 WP_016324748.1.12882 WP_016324748.1.13814 WP_016324748.1.14980 WP_016324748.1.15730 WP_016324748.1.16985 WP_016324748.1.1883 WP_016324748.1.21208 WP_016324748.1.21650 WP_016324748.1.26652 WP_016324748.1.29540 WP_016324748.1.30741 WP_016324748.1.31500 WP_016324748.1.36933 WP_016324748.1.37152 WP_016324748.1.40264 WP_016324748.1.41886 WP_016324748.1.44575 WP_016324748.1.44658 WP_016324748.1.51576 WP_016324748.1.57060 WP_016324748.1.6267 WP_016324748.1.6878 WP_016324748.1.6981 WP_016324748.1.71998 WP_016324748.1.74614 WP_016324748.1.77953 WP_016324748.1.78023 WP_016324748.1.78517 WP_016324748.1.78774 WP_016324748.1.78809 WP_016324748.1.82066 WP_016324748.1.85813 WP_016324748.1.87280 WP_016324748.1.88866 WP_016324748.1.90060 WP_016324748.1.91807 WP_016324748.1.91857 WP_016324748.1.94972 WP_016324748.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]