SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507717478|ref|YP_008050087.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717478|ref|YP_008050087.1|
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.31e-25
Family Sigma2 domain of RNA polymerase sigma factors 0.0015
Further Details:      
 
Domain Number 2 Region: 116-178
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.000000000000187
Family Sigma4 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|507717478|ref|YP_008050087.1|
Sequence length 191
Comment RNA polymerase sigma-E factor [Paenibacillus polymyxa M1]
Sequence
MEKLNTDNQNTDINLVIEQVQAGDKQAYTHIIRRYQQQIFLYCYYLLKNREEAEDAAQEI
FIRGLEHIHHFVPTVSFSAWLYKIAQNHCTDLLKRNARTFKSFIQYKLNLKQQPIHEYTN
LIHELLDQLTLKDRQILLLRSLEDYNYEEIATIMGLKSSTIRKRYERLRKKLINYNEKGG
KQIEHSFKPGR
Download sequence
Identical sequences E3EAN5
gi|310644275|ref|YP_003949034.1| gi|507717478|ref|YP_008050087.1| WP_013373332.1.13814 WP_013373332.1.14980 WP_013373332.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]