SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|316931715|ref|YP_004106697.1| from Rhodopseudomonas palustris DX-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|316931715|ref|YP_004106697.1|
Domain Number 1 Region: 39-404
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 2.09e-120
Family MLTA-like 0.000000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|316931715|ref|YP_004106697.1|
Sequence length 475
Comment MltA domain-containing protein [Rhodopseudomonas palustris DX-1]
Sequence
MIAAALMLVPTTSDARSRHHHHGAKSSHHAGSHPRHRHVLWPLQIADGQYLPAGWDQLPG
WEDDDHLAAFKTFRASCRPILAGRGRADAKPLGDSLREPCRAARASAISTEPVARAFFER
HFVPLLISRIGETQGFVTGYYEPVIDGSPVKTDDYTVPVYRRPSNLFVRGYTQGAALPNG
GPVFRKVGRRKLVPYYDRGAIEDGAIEGRGLEICWLKSQTDLLFAQIQGSARIRLPDGRV
VRINYDAHNGYPYTPVGRILIERGIIPREEMSMHRIREWMDANPDGAKELRRANRSYVFF
RKVDLNDDDEAVGAQGVPLTPWRSIAVDKGLHVYGTPFFISGELPIESVNARTPFRRLMI
GQDTGSAIVGPARADLYFGAGAEAGAVAGRIRHPIGFAILVPTSLDPVASGRTLPLPEPR
PPAKARKPAATPAKSGGKDGAAIVPTPEARPAATPSQPQARRHHPHHHRHHRRPH
Download sequence
Identical sequences E6VI68
gi|316931715|ref|YP_004106697.1| WP_013500163.1.10230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]