SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325298369|ref|YP_004258286.1| from Bacteroides salanitronis DSM 18170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325298369|ref|YP_004258286.1|
Domain Number 1 Region: 300-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.37e-39
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 41-295
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.22e-20
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 756-830
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000103
Family Smr domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325298369|ref|YP_004258286.1|
Sequence length 831
Comment MutS2 protein [Bacteroides salanitronis DSM 18170]
Sequence
MIYPQNFEQKIGFDQIRNLIKAKCLSTLGEEKTDGMAFSSDYEEINCRLEEVVEFVRILE
EEDEFPSQYFFDVRPSLKRIRVEGLYLDEQELFDLRRSLETIRDIVGFLQKEDEEDEDSH
SPYPALHALAADILVFPQLIARINNILDKFGKIKDNASAELLRIRRELADTTGSISRSLN
SILRSAQAEGFVEKDVTPTMRDGRLVIPVAPGMKRKIRGIVHDESATGKTVFIEPAEVVE
ANNRIRELEGEERREIIRILTEFSATIRPQVPAILQSYEFLALIDFIRAKALFCMDIKAV
KPAFEEQQIIDWIEAVHPLLQKSLAKHNKKVVPLDIELTSRQRILLISGPNAGGKSVCLK
TVGLLQYMLQCGLLIPLNERSHAGIFENIFIDIGDEQSIEDDLSTYSSHLTNMKNMMKYC
NGKSLILIDEFGGGTEPQIGGAIAEAVLKRFNQKQTFGVITTHYQNLKHFAEDHEGVING
AMLYDRHEMRALFQLQIGNPGSSFAVEIARKIGLPEEVIADASEIVGSEYIQSDKYLQDI
VRDKRYWETKRQNIRKKEKQMEDTIARYQQEIEELERKRKEILQKAKEDAEHLLQESNAK
IENTIRTIKEAQAEKERTRTARQELADFKQEVETIDTAALEEQIARKMERLREKQKRKEE
RKNKKAETAPMQPKAKPICTGDYVRIKGQTSVGQVLELNGQNAVVMFGLMKTNVKTERLE
HADPPKTSNVMAKATFVSSETQEQMYQKKLNFKQDIDVRGMRGDEAIQAVTYFIDDAIQV
GVSRVRILHGTGSGILRTLIRQYLATVPGVAHFQDEHVQFGGAGITVVDLK
Download sequence
Identical sequences A0A1Y3X8K9 A0A1Y4DZ85 F0R706
WP_013617248.1.2583 WP_013617248.1.28355 WP_013617248.1.60740 gi|325298369|ref|YP_004258286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]