SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325299188|ref|YP_004259105.1| from Bacteroides salanitronis DSM 18170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325299188|ref|YP_004259105.1|
Domain Number 1 Region: 446-660
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.41e-29
Family ABC transporter ATPase domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 189-443
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000000000017
Family DNA repair protein MutS, domain III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325299188|ref|YP_004259105.1|
Sequence length 665
Comment DNA mismatch repair protein MutS domain-containing protein [Bacteroides salanitronis DSM 18170]
Sequence
MNFYFVILSVSEGSRKQKRMYTRSFALLRMTLLLITGFAIRRDKQSEKRFFILNSSFKKF
FIHPMAPNTWYTQRIDETSRQLSQTKAQINRISLLRVLLFVAGFAGLILFYRAGTWAVVL
TVCCTFLPFFILVKVHNRLYFRKEQLETQLKLNQDELKGLEGDYSAFDEGREFINPGHPY
SYDLDLFGRKSLFQALGRTCTHIGKQTLAAWMRHHLTEKAAIETRQESIRDMSRRMEFRE
AFRVTGSINRSADSDEEEISRWSRTPSVLQHLWWVKLCLWAVPGINILLLALGLLHILSL
SWFGMMFTIFVILSFALIQRVTLIQESYGKKLKTLNRYAKLITLAKGETWQAPALRELTD
KLDIDGHSPAEALTQLSKELDRLDLRNNQLLYVILEGSMFFQLRQIVRIERWKARYGKYL
MGWLEAVGELDALCSLGTFAYNHPAYTYPTITNQPFCFLARNMGHPLMPEAQCVKNDAAI
PSRPFFLIITGANMAGKSTYLRTIGVNYLLACMGCPVCCESLTLYPAQLITSLRTTDSLS
DNESYFFAELKRLKRIIDLLNEGQELFIILDEILKGTNSADKQKGSLDLIRQFMRLNADG
IIATHDLLLGTLADQFPQHIRNYCFEADIKDNELIFSYRLREGVAQNMNACFLMKKMGIT
IDGGD
Download sequence
Identical sequences F0R3K0
gi|325299188|ref|YP_004259105.1| WP_013618061.1.2583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]