SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325300304|ref|YP_004260221.1| from Bacteroides salanitronis DSM 18170

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325300304|ref|YP_004260221.1|
Domain Number - Region: 23-96
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0915
Family DNA repair protein MutS, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325300304|ref|YP_004260221.1|
Sequence length 219
Comment hypothetical protein [Bacteroides salanitronis DSM 18170]
Sequence
MSIKELNCIYAFGYGLFIYSPGTFNEWMKEKKCRAKKMLSYLDKHKDMFLEMIAKGIALP
IYQIPTYQYSIYITTKKDVNIPEDWEQVYLYKDWFLTIGTDDKLCFSSFEFFEEHRDLIA
KSQCVFMGEVFDINDNPHSFYHSDEIQMPKGNYRFDIYGLKRKHPFSETDRENCNKNYAY
LFAFRKVDNDSNENLERCDNDTHIFSIEEYLEEVHNKKR
Download sequence
Identical sequences F0R4C8
WP_013619111.1.2583 gi|325300304|ref|YP_004260221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]