SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325300320|ref|YP_004260237.1| from Bacteroides salanitronis DSM 18170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325300320|ref|YP_004260237.1|
Domain Number 1 Region: 83-236
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 2.62e-38
Family PA2201 C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325300320|ref|YP_004260237.1|
Sequence length 245
Comment hypothetical protein [Bacteroides salanitronis DSM 18170]
Sequence
METRDKLFTEEQYIKQLAKYYCRIEKLNSMIEQSEKDGDEISPDLYGRLFDCRVYTIVTM
YSMGENLEFIKSNYISTINVLEKCWTPYGYYVQMLWLLSIGIMLEYDNNVIHKLRVLIDM
KEVKDRVYDVLLNYRFPERKEMADCVFDAVPYRAILEVSDLAKTNKTQATKRLEKYLKRE
WYRGHSDCAWHDDHKYGLIHDGYWCFESGALVKVLGLDDSSLKGLPYYPYDMVHWNEIKY
DVNEA
Download sequence
Identical sequences F0R4E4
gi|325300320|ref|YP_004260237.1| WP_013619126.1.2583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]