SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332661945|ref|YP_004451414.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332661945|ref|YP_004451414.1|
Domain Number - Region: 26-92
Classification Level Classification E-value
Superfamily AF1862-like 0.0405
Family Cas Cmr5-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332661945|ref|YP_004451414.1|
Sequence length 137
Comment hypothetical protein Halhy_6726 [Haliscomenobacter hydrossis DSM 1100]
Sequence
MLTKMINKLELPLIQKAFDALINCHILHVADKKTKYPVDTKDYVPICSDFIYNVFNIGLL
ETCLYFEKNPTGSDVEQKRATFCKALFYYITGKYKGFLSNYVEEIKTGDMGKLQHEIKQA
VDYFKLAIQVSQPIKQK
Download sequence
Identical sequences F4L833
gi|332661945|ref|YP_004451414.1| gi|332661945|ref|YP_004451414.1|NC_015512 WP_013769057.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]