SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332664598|ref|YP_004447386.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332664598|ref|YP_004447386.1|
Domain Number 1 Region: 7-316
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.92e-78
Family Methylenetetrahydrofolate reductase 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332664598|ref|YP_004447386.1|
Sequence length 318
Comment 5,10-methylenetetrahydrofolate reductase [Haliscomenobacter hydrossis DSM 1100]
Sequence
MKVTEYFEKAQGQTLISFEILPPLKGGSMQDIFKGLDPLMEFKPPFIDVTYHREEFIYKQ
NPAGFYEKVAIRKRPGTVGICAAIMNRYGVDAVPHLLCGGFTREQTEDALIDLNFLNVQN
VLALRGDARQFDSKFEPEPGGHEFALDLVKQIDDMNHGKYLDLNIENGQRTNFCIGIAGY
PEKHFEAPNIESELAWIKAKVDAGANYIVTQMFFDNKHYFDYVANCRAAGINIPIVPGLK
PITKQYQLTSIPRHFFIDLPEALVKEFNKAETPEARRQVGTEWCSAQSKELKAAGVPCLH
YYTMGDAPTIRKIVESVY
Download sequence
Identical sequences F4KZS7
WP_013765061.1.50710 gi|332664598|ref|YP_004447386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]