SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332665554|ref|YP_004448342.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332665554|ref|YP_004448342.1|
Domain Number 1 Region: 1-293
Classification Level Classification E-value
Superfamily Folate-binding domain 4.87e-97
Family Aminomethyltransferase folate-binding domain 0.00000013
Further Details:      
 
Domain Number 2 Region: 288-376
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.64e-26
Family Aminomethyltransferase beta-barrel domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332665554|ref|YP_004448342.1|
Sequence length 377
Comment glycine cleavage system protein T [Haliscomenobacter hydrossis DSM 1100]
Sequence
MKNTPLTEKHIALGAKMAPFAGYNMPISYTGIQEEHHTVRDKVGVFDVSHMGEFIVRGKQ
ALELIQQITTNDASKLGIGQAQYSAMPNEQGGIIDDLLVYRLPEDNCADGERAYMMVVNA
SNIEKDWNWVNAHLEPNAEFIRGFDTKVINISDQTSLIAVQGPKALQTLQPLTGIDLSRI
KYYNFAKGKFAGFDNVLISATGYTGAGGFEIYVDNKQAAAIWDAVFEAGKTLGIAPIGLG
ARDTLRLEMGFCLYGNDIDDTTSPMEAGLGWITKLSKPSFIGKSIFEAQKAAGLSRKLVG
FMLEDRRIPRHDYAILDAQGQNIGKVTSGSQSPTLGKPIGMGYVQTAYSSPGSEIFISIG
GKSLPATVVKLPFLQQS
Download sequence
Identical sequences F4KYS7
gi|332665554|ref|YP_004448342.1| WP_013766008.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]