SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332666184|ref|YP_004448972.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332666184|ref|YP_004448972.1|
Domain Number 1 Region: 634-803
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.32e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0014
Further Details:      
 
Domain Number 3 Region: 506-642
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.96e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.021
Further Details:      
 
Domain Number 4 Region: 153-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.03e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332666184|ref|YP_004448972.1|
Sequence length 835
Comment nitrite reductase (NAD(P)H) large subunit [Haliscomenobacter hydrossis DSM 1100]
Sequence
MMRIIVIGNGMVGYKFCEKWLAQAPQGTYELHVFGEEPRPAYDRVHLSDYFSGKTEQDLY
LAPAEWYANHGITLHLGELVTQIDREAKTLSTHKGLVFTYDKLILATGSAPFVPLITGTD
KQGVFVYRTIEDLEQITQYGMKLAAKGIATPAAVLGGGLLGLEAAKAVRDLGLETHVVEF
APRLMPRQLDERGGDLLREAIQGIGVQVHLSKNTSLIAGQERISHLEFVDGSALPAEMLV
ISAGILPRDELARLCGLEVGPRGGVVVDEYMRSSDPNVYAIGEVALYQGMVYGLVAPGYE
MAEVAVGNILGKTTSMSPVVDLSTSLKLIGIDVASFGDVFGTQAPHRAIVFEDKLKGIYK
RLNVSEDGKKLLGGILVGDASDYNQLLQIYKNAITLPPEPEALIVKLAGGESAFGSVLDL
PDAAVICSCESVSKGQICAAVSEAGCETLKAITKCTKAISGCGGCKPMVDDLLKGTLKAM
GKTVKETVCEHFPHSRQELFDIVKVKNYTRFETVIAEHGTGYGCEVCKPVLASIFASIHA
ETAVAQSGIQDTNDRFLANIQRNGTYSVVPRIPGGEITPEKLIAIGEVAQKYELYTKITG
GQRIDLFGARLDDLPFIWEELIAAGFESGHAYGKALRTVKSCVGSTWCRFGMLDSVSFAI
EVEERYKGIRAPHKIKGGVSGCIRECAEARGKDFGIIATEEGWNLYVCGNGGANPKHAVL
LAEKIDSPTCLRYLDRFLMFYIKTAGPLVRTAPWLEKMEGGINYLREVIVNDSLGIGAEL
DVDMANLINNYQCEWKEAVENPAIRARFKHFVNSEDTDENIEFVSLREQKMPRAW
Download sequence
Identical sequences F4L723
WP_013766637.1.50710 gi|332666184|ref|YP_004448972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]