SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332667792|ref|YP_004450580.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332667792|ref|YP_004450580.1|
Domain Number 1 Region: 125-281
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.59e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 402-565
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-29
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 17-124
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.08e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0091
Further Details:      
 
Domain Number 4 Region: 260-284,314-415
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.83e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332667792|ref|YP_004450580.1|
Sequence length 718
Comment ferredoxin--nitrite reductase [Haliscomenobacter hydrossis DSM 1100]
Sequence
MSNYEFDFSSVSPVDQKDIKELDRRISDFQRGKEDTERFRLYRLTRGVYGQRQEGVQMFR
LKLPYGRINSEQLVRIADVSDRYATGNLHITTRQNVQLHYVKLANSPKVWTELAQLNLTA
REACGNTVRNFTGSPTAGIDPNEPFDVSPYVEASFQYFLRNPICQEMGRKIKIAFSSSDA
DSAFTYFHDYGFIPRMQVVDGVEQRGFKVLVGGGLGAQSITGLLAYEFLPEDQIIPFMEA
GLRVFDRYGEREKRMKARMKFLIQKLGFEAWMELVKQEWKALKNKSVAIDHNLVPEQAPL
GTGIIPADVKPVDEHWYNEWLRTNTFEQKQKGYYGVYVRIVLGDLPSHKARALAAVIKAY
AADDIRFTINQGILLKFIRPEALPLWFNELHKLGLALPGADSTADITACPGTDTCALGVT
NSTGLSNILEELIREEYPDLIDEKFFKIKISGCMNACGQHMAANLGFHGSSFKHGDLVIP
AMQVVLGGGVAPDGRGFIADKIVKVPTKRIPDVVRYVLDDFEKNGLEGEYYNDYFLRQGD
KYFYTLLKPLADLKTMTQEEYFDWGQDHLYKQEIGVGECAGVMLDMVGVILKDAVEKIAA
AREALEQSQWSDAIYSSYSAFVVAAKGMLLSKDVKCNTQKGVIDDFQTHYVESGDYTEMG
NFAELVLQINQYEPEENFASDYVTQAEHFVNSVIALREAQLETSNGIDKKVVGDYYRA
Download sequence
Identical sequences F4KZ53
gi|332667792|ref|YP_004450580.1| WP_013768235.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]