SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332668004|ref|YP_004450792.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332668004|ref|YP_004450792.1|
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily AF1862-like 2.09e-24
Family Cas Cmr5-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332668004|ref|YP_004450792.1|
Sequence length 129
Comment Cmr5 family CRISPR-associated protein [Haliscomenobacter hydrossis DSM 1100]
Sequence
MDKNTLRNSMEQRRAQAAYQDATNGFKQQSKEYVAFVNELPMLIKTNGLGATIAFATYKN
DASKMVYRQLENWLKQEVNQYLLPDLQSDKRLIAALTDCSSSAYKAVTVELFAYLIWLRR
FAKALDKDA
Download sequence
Identical sequences F4L2K1
gi|332668004|ref|YP_004450792.1| WP_013768441.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]