SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332668285|ref|YP_004451073.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332668285|ref|YP_004451073.1|
Domain Number 1 Region: 97-415
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.26e-80
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332668285|ref|YP_004451073.1|
Sequence length 419
Comment proline dehydrogenase [Haliscomenobacter hydrossis DSM 1100]
Sequence
MENSSGPYRKKIDEMSDLMKDMLNLTKDLQLDFSNTQIAFADRSDKELNKTAWLFGLLNH
QWLVGIGSKIGLAAIKLHLPFVQGAIKNTIFEQFCGGTTLLEAQKTIDRLQRSNIKTILD
YGAEAKEDESELNHTMNENLRSIEFASKQSFVPIISTKLSGLGRFELLESVQAGVAFTEE
TKSEYKSILRRLDAICHAASTKGMSVFIDAEESWIQDTVDHLAEMMMKRYNTERAVVYTT
CQMYRHDRLQYLYELYERAQKEGYLLGVKLVRGAYMEKERDRAEEMGYSSPIHATKEATD
EAYNTALRFCINHHDKIASCNASHNTDSALLQAKLMVERNIPRNHPNLMFCQLYGMSDTL
TFNLAAAGFNAAKYVVYGSVREVVPYLIRRAQENTSVTGDMSREYRLVADEIKRRGLKM
Download sequence
Identical sequences F4KQ39
gi|332668285|ref|YP_004451073.1| WP_013768720.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]