SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|440288220|ref|YP_007340985.1| from Enterobacteriaceae bacterium strain FGI 57

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|440288220|ref|YP_007340985.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 8.5e-29
Family YccV-like 0.00000561
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|440288220|ref|YP_007340985.1|
Sequence length 105
Comment hemimethylated DNA binding domain protein [Enterobacteriaceae bacterium strain FGI 57]
Sequence
MIASKFGIGQQVRHSLLGYLGVIVDIDPEYSLDEPEPDELAANDELRMLPWYHVVMEDED
GQPVHTYLAEAQLSGEVREDHPEQPSMDELARTIRQQLQAPRLRN
Download sequence
Identical sequences L0M7R2
WP_015965043.1.78941 2030526337 gi|440288220|ref|YP_007340985.1| 2030823726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]