SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336065632|ref|YP_004560490.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336065632|ref|YP_004560490.1|
Domain Number 1 Region: 53-232
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-34
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336065632|ref|YP_004560490.1|
Sequence length 238
Comment B3/4 domain-containing protein [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MKQFIITDDFWSLFPDACFGIVLAHDVQNKDLTPEAMTAISKFLDESHHEAQKYLTEDVL
SQNAVVSVWRDAYQKFKTKKGARVSIEALLKRVSKGNTIGSINPLVDIYNAISLTYGLPC
GGEDIDTFVGALQLIKTQGNDSFMALGDSEPDNTLPGEIAYVDDVGAVCRCWNWRDGQRT
MLTDDTTNAFLIIECVDPTRRDDLEKATHHLATFVEQHLGGSVKSTIMDYENASLNLE
Download sequence
Identical sequences E7FXF9 F5WRR7
WP_003775457.1.1456 WP_003775457.1.14972 WP_003775457.1.27465 WP_003775457.1.4665 WP_003775457.1.5295 gi|509154102|ref|YP_008074343.1| gi|336065632|ref|YP_004560490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]