SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336065668|ref|YP_004560526.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336065668|ref|YP_004560526.1|
Domain Number 1 Region: 16-91,183-358
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.6e-61
Family Bacterial dinuclear zinc exopeptidases 0.00000112
Further Details:      
 
Domain Number 2 Region: 81-191
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.58e-32
Family Aminopeptidase/glucanase lid domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336065668|ref|YP_004560526.1|
Sequence length 369
Comment peptidase, M42 family [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MKKNITLEEAYGDVNLEMLADFTLTNGISGHEKDVANVFKSWVEESADDICFDNLGSIIA
HKKGAENGPKIMLAGHIDEVGFLVRSIDDNGFLRIHPVGGWWPHVLLSQPVTIQTRDGKM
YVGVTGSKAPHGMTPAVRNKVMDITEVFVDLGVASKDEVELLGIQVGDTVTPKSDFHVLA
NPNFLMSKAWDDRIGAAIVVDVMRQLKDVQTASHIYSVGTVQEEVGLRGARTAAQTINPD
IAFAVDVTIATDTPGEDNRIKMGVGATLEVMDGSVIGHKGLLYYLQDLAEEMNIDTQFEI
LAAGGTDSGEIHKVHDGVITLTLSIPARYIHSHLGIIHRKDYADTVALITEFCKRCDADV
LESLQNYKR
Download sequence
Identical sequences E7FUF1 F5WRV3
gi|336065668|ref|YP_004560526.1| gi|509152366|ref|YP_008072607.1| WP_003773008.1.1456 WP_003773008.1.14972 WP_003773008.1.27465 WP_003773008.1.4665 WP_003773008.1.5295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]