SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336066181|ref|YP_004561039.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336066181|ref|YP_004561039.1|
Domain Number 1 Region: 214-398
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.26e-47
Family B3/B4 domain of PheRS, PheT 0.0000282
Further Details:      
 
Domain Number 2 Region: 44-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-39
Family Myf domain 0.0035
Further Details:      
 
Domain Number 3 Region: 469-687
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.96e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00038
Further Details:      
 
Domain Number 4 Region: 695-791
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.7e-22
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 5 Region: 406-476
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.04e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336066181|ref|YP_004561039.1|
Sequence length 791
Comment phenylalanyl-tRNA synthetase subunit beta [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MLVSRKLLNRYVDIADIDTLTLADTLTNAGLEVEGIEPLIHGTHLTVGHVLECVPHEDSD
HLNVCQVDLGDRVEQIVCGASNIKAGLYVCVAQVGSVLPGDFNIKASKVRGVESNGMICS
LNELGVAEKFQTEEQKTGIVVLPKAEPGSNPAVALGLDDEILDISQTPNRSDFMSIISIA
HEVSALFGRELTLPQFDGASDTGSETELKIQSYTEKSPLFLGKVIGNITIGTSPAWIREA
LIGSGIKPINNVVDISNLVMLETGHPMHFYDIDFLKNQDLSVRDDFEGTVEALDGQTYDL
EKNDLVIMNGSVPVGIAGIMGLGNSMIQPHSRGLVIEVARFNHVSVRKTATRLGLSSESS
TRYTKPMDNNASKQAMDRAVSLLMEYASASALEETVQWGSLDSTPVVVSITVDRINKYLG
TALEEAEIINVFERLNFKPQNLDGNITCTIPSYRKDIAIEEDLIEEVIRIVGYDVMDETL
PLMDLTLGNLNDQQLKARMIEDVLLGFGADQILSYTLVDESKTVGSESLGSPIRLANPIS
DKRAYLRTHLLPSMVEVLAYNNAHKISDVLFFEQSSVYAKGAKSNRLGVIGQGSLWNQNW
TKTDIPLDFYTLKGMIMELFEKLGFNEKRFQFKPSGFDDTKFHPFKSAEILFDRKHLGVI
GQLHPLYAKEYDLKDPIYLEIDLDYLLGQKAGAIKATSVAKYPIMTRDLAILCDNEVAVS
DLIQSIEKVSRKYLVDLNVFDVFTSEKLGNKKSIAFQLSFGQDRTLEVEEINDIMNAVIE
ELKKRFNVEVR
Download sequence
Identical sequences F5WTB6
WP_013853013.1.1456 WP_013853013.1.27465 WP_013853013.1.4665 WP_013853013.1.5295 gi|336066181|ref|YP_004561039.1| gi|509152854|ref|YP_008073095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]