SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336066395|ref|YP_004561253.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336066395|ref|YP_004561253.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.33e-33
Family Ribosomal protein L6 0.0000266
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.2e-26
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336066395|ref|YP_004561253.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MSRIGNKTITIPAGVEVELKAGNEVTVKGPKGTLTRQFSELYEIEINGSEINVKRPNDSK
KVKQLHGTTRSLIANMITGVSEGFTKSLELVGIGYRASKSDNKLVLNVGYSHPIEFELED
GVDIEVPSATAINITGVDKQRVGEWAANIRATRKPEPYLGKGIKYKNEVIRRKEGKTAAK
K
Download sequence
Identical sequences E7FW40 F5WTY0
gi|336066395|ref|YP_004561253.1| WP_003775214.1.1456 WP_003775214.1.14972 WP_003775214.1.27465 WP_003775214.1.5295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]