SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336066551|ref|YP_004561409.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336066551|ref|YP_004561409.1|
Domain Number 1 Region: 4-82,178-339
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.81e-45
Family Bacterial dinuclear zinc exopeptidases 0.00000482
Further Details:      
 
Domain Number 2 Region: 70-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 7.02e-26
Family Aminopeptidase/glucanase lid domain 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336066551|ref|YP_004561409.1|
Sequence length 343
Comment peptidase, M42 family [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MKHLIHDLETLLNIKSPTGNTEEAVLFCEERFKALGLKTRRTVKGALIASLEGECTEKEV
TLSAHVDTLGCLVKEITSDGKLRLTQLGGYAWSTIEGEHVAIETLSGSFYSGTILTNVAS
SHVHGALTSTTERTQKNLEVRIDEKVKTHDDVVALGINVGDYVHLDPRCKTTDSGFIKSR
HLDDKACVIALFGIAEHFVSTKTKPSYTTNFFISTFEEVGHGSSAAIPEKTFEFIAVDMA
APGQGQTSDEFSVTICAKDSSGPYDYDLRKRLVALASQNNIPHKIDIYPYYGSDASAALR
AGYDFKAGLIGPGVDASHSFERTHEEAIKATIDLGIAYLSSKF
Download sequence
Identical sequences F5WUD6
WP_013853256.1.1456 WP_013853256.1.27465 WP_013853256.1.4665 WP_013853256.1.5295 gi|336066551|ref|YP_004561409.1| gi|509153296|ref|YP_008073537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]