SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336066823|ref|YP_004561681.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336066823|ref|YP_004561681.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 8.89e-21
Family Ribosomal protein L9 C-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.71e-18
Family Ribosomal protein L9 N-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336066823|ref|YP_004561681.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MKLILLKDVKKVGKKNDIVEVADGYARNFLLPNKLAVMASDQSREILDHQKQEHAAEVQA
EIEKAKLLAKELEKITLEFKVKVGEGGRVFGSVSTKQVEDALKKEHKIKVDKRKFKPSGP
ITHLGSNRIQATLYGDVTGEIHVKLIAE
Download sequence
Identical sequences F5WV58
gi|336066823|ref|YP_004561681.1| WP_013853429.1.1456 WP_013853429.1.14972 WP_013853429.1.27465 WP_013853429.1.4665 WP_013853429.1.5295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]