SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336066837|ref|YP_004561695.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336066837|ref|YP_004561695.1|
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.56e-44
Family PP-loop ATPase 0.0011
Further Details:      
 
Domain Number 2 Region: 318-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000575
Family B3/B4 domain of PheRS, PheT 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336066837|ref|YP_004561695.1|
Sequence length 400
Comment tRNA(Ile)-lysidine synthase [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MMHKKWIVGVSGGPDSMALLDILSKQNIPCVAAHVNYGKRETSKRDEDIVRKYCEKNHIP
FECSNYEDDGKNHNFQHQARAFRYAFFKELVLKYNAEGVAIAHHFNDDLETYLFQKQRKM
ESEHVGLAQYTEIMDVTVWRPLLDMTKDMVVQYCDDHQIQYGIDESNLSLDYTRNQIRND
IHYMDENSYESLVKEMLAAKQYGEKRSKMVKSIALQLDSKVKVDMYALIQDGIRPRVLRL
WMAQNGVETHTMSGPFLKELDTLILQEKAFIQFGNKRLSSSYGELAITDNTPYEYHFTQI
SHVTTDHFVLSDSGQTIQGVTLSESDFPIMIRNARKGDSIKMRFGTKSLNRFFIDRKIPR
HEREIWPVIVNSSQQIVFVVGMGCDEHHYSNNPNLFMLEL
Download sequence
Identical sequences F5WV72
gi|336066837|ref|YP_004561695.1| WP_013853435.1.1456 WP_013853435.1.27465 WP_013853435.1.4665 WP_013853435.1.5295 gi|509153602|ref|YP_008073843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]