SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315125274|ref|YP_004067277.1| from Pseudoalteromonas sp. SM9913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315125274|ref|YP_004067277.1|
Domain Number 1 Region: 144-338
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.94e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000537
Further Details:      
 
Domain Number 2 Region: 423-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.63e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000198
Further Details:      
 
Domain Number 3 Region: 6-140
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.13e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 
Domain Number 4 Region: 340-416
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.16e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315125274|ref|YP_004067277.1|
Sequence length 565
Comment sulfite reductase subunit beta [Pseudoalteromonas sp. SM9913]
Sequence
MSEQDKTVKLSDNERLKRESNFLRGTIAQDLKDEITGGFTADNFQLIRFHGMYQQDDRDI
RPERAKQKLEPLHNVMLRARMPGGIIKPEQWLAIDKFAGEKTSYGSIRLTTRQTFQFHGV
LKPEIKGMHQLLNSVGIDSIATAGDVNRNVLCTTNPVESELHQEAYEWAAKISEHLLPKT
KAYAEIWLNGEKSETTEEPILGSTYLPRKFKTTVTIPPNNEVDVHANDLNFVAIADNGKL
VGFNVLVGGGLAMTHGDTATYPRKADDFGFIALEDTLKIAEHVVSVQRDWGNRSNRKNAK
TKYTLDRVGSGVFKAEVEKRAGVSFAPSRPYEFTHRGDRIGWVEGIDGKHHLTLFIQSGR
ILDYPNKPLKTGCRKIAEIHQGDFRMTANQNLIIAGVPADQKAIIEKIAREHGLIDDKDT
EQRKNSMACVSLPTCPLAMAEAERYLPSLIEKIEGLLAKHGVPNDSIIMRVVGCPNGCGR
AMLAEAGLVGKGPGKYNVYLGGNTEGTRIPKLYLENVGEEVYLEAFDKLIGQWVSERNEG
ECFGDFVIRKGIVAEVKVSVTDFYA
Download sequence
Identical sequences A0A290TBN2
WP_013463783.1.24908 WP_013463783.1.9709 gi|315125274|ref|YP_004067277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]