SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308051426|ref|YP_003914992.1| from Ferrimonas balearica DSM 9799

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308051426|ref|YP_003914992.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.09e-54
Family Molybdopterin synthase subunit MoaE 0.00000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|308051426|ref|YP_003914992.1|
Sequence length 148
Comment molybdopterin synthase subunit MoaE [Ferrimonas balearica DSM 9799]
Sequence
MIAVQTQDFSVADEYAKLADNPGCGAVVTFVGKVRDFGDSRGVSAMTLEHYPGMTEAVLH
QIEAEARQRWPLDEVTIIHRVGELQLCDQIVFIGVSSAHRKAAFAACEFLIDFLKTRAPF
WKKETSDDGTVWVDAKDADQQAAEQWQR
Download sequence
Identical sequences E1SQE7
gi|308051426|ref|YP_003914992.1| WP_013347223.1.80209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]