SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|308047766|ref|YP_003911332.1| from Ferrimonas balearica DSM 9799

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308047766|ref|YP_003911332.1|
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.02e-34
Family Pyruvate oxidase and decarboxylase Pyr module 0.0036
Further Details:      
 
Domain Number 2 Region: 373-564
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.2e-29
Family Pyruvate oxidase and decarboxylase PP module 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|308047766|ref|YP_003911332.1|
Domain Number - Region: 225-370
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000414
Family Pyruvate oxidase and decarboxylase, middle domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|308047766|ref|YP_003911332.1|
Sequence length 569
Comment 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Ferrimonas balearica DSM 9799]
Sequence
MNTSHCAELNLLWARLMLEELHRLGVRHLCLAPGSRSTPLTLAAAGHDGFQRHTHFDERG
LGFAALGLAKASQSPVAIITTSGTAVANLYPAVIEAYQTGVPLVVLSGDRPPELIACGAN
QAIIQPAIFANYARRLDLPTPSLEIPPQTLLAQLDQVMVDLDRPLHINCMYREPLYPEGL
DAPFETYLTPLSEWRKTAEPWAATPAMSRSALPSADDCCSFAQGKGIIVVGTLGPHQQPE
QILALARRLGWPILADAQSQLRQAEGVVHHIDQLMHHPKALKLLGKAEHLLLIGGRLLSK
RLMSFIAQHPWQAFWHYMGHAENLDPAHLRKRRFVGSLPMLAALPWPLLPGSGWADALES
YSDEVERLAAEQHDQGALTELSAVRLLSRQLGADQQLFIGNSLPIRLFDMLAAPGDAPAI
FTNRGASGIDGLLATSCGVAMAEGKPTVLVVGDLSLLHDLNSLALARSLTSPLVVMVLNN
DGGSIFNMLPVPSDALRQQYYRLGHGFGFEGAASQFHLPYQRPDSLDALQQALSEGLQRD
GASVIEVVVPPNESAELIVEMARQIRGDD
Download sequence
Identical sequences E1SVA4
WP_013343564.1.80209 gi|308047766|ref|YP_003911332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]