SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374320712|ref|YP_005073841.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374320712|ref|YP_005073841.1|
Domain Number 1 Region: 136-294
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000224
Further Details:      
 
Domain Number 2 Region: 391-533
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 10-135
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.15e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.00028
Further Details:      
 
Domain Number 4 Region: 271-402
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.29e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374320712|ref|YP_005073841.1|
Sequence length 541
Comment ferredoxin--nitrite reductase [Paenibacillus terrae HPL-003]
Sequence
MAYEPIWSAHPDKLNKFEFAKLEKDGLDVIRTIIENYASEGFDSISADDMDRFKWAGVYQ
QKPKDGHFMMRVRINTGIMTSAQAHALADISTLYGRGLVDVTTRQAIQFHWLTVQDLPDI
FERLEKVDLYSFEACGDCPRTIVGNPLAGIDPNELVDTKDIVDEVNRFFVLNRDFSNLPR
KYKMSISGNTYNNAQAEINDLSFTPATKVINGEEVIGFHVMVGGGLSAKPHLAQSLDLFV
RPDEVLKVSIAVTTIFRDYGYREKRHHARLKFLIADWGPEKFLAKLTEYIGEMPGRGEDK
TIGWQAAYFDGVHPQAQQGLNYVGLNVPVGRLDADELHELADLADRYGDGQIRTTMSQNI
LLSGVPDDQVDELLQAPVLQRLTPRPKHFMSRTVSCTGNEFCNLAIVETKKRAIDVAEYL
DQHVDLDEKVRIHFIGCPNSCGQKNIADIGLQGSLIKTPEGMADAFDIAVGGALGPGAQF
NKALKGRVRGDQVGPVLAELILFYKENRNAGETFHAYVQRVGIPTFQEKLSAILQSSTVA
S
Download sequence
Identical sequences G7VUL1
WP_014278373.1.37039 gi|374320712|ref|YP_005073841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]