SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374322381|ref|YP_005075510.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374322381|ref|YP_005075510.1|
Domain Number - Region: 184-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0889
Family DNA repair protein MutS, domain III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374322381|ref|YP_005075510.1|
Sequence length 366
Comment tellurite resistance protein [Paenibacillus terrae HPL-003]
Sequence
MATPWAELKKEDEQKVTEEASQLIQKVSQSDVMSLDTLMDDIGKLGVKTQERAGQTLKML
DRPVNDLMSGDRAEVSSMILKLRDECETLQQSKNVSFFGKLLRKSPLKNYIYKYQSVKTN
IEQIITALRDGKDNLEENIVSMRQLKKASIEEIYNLQTKIAFGNRLKELFETEIAKPENE
TRKPHLERGLRKVVTRTQSMTEMILLYNQAIAATDIINDNNDKLIDSVNNAIDKTSNLIT
VSAMIAMALADQDKIISAVDATNRTIENQFKENAKLLKTTTERTTDLLSKPSMSLEAVNQ
AIGDLVSALDLSEKSNRQIIESCHDYTSKMTAINANLSQRLGIEGKEQPKSLKDKDSSEG
LSSFLN
Download sequence
Identical sequences G7W447
gi|374322381|ref|YP_005075510.1| WP_014280015.1.37039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]