SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374322955|ref|YP_005076084.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374322955|ref|YP_005076084.1|
Domain Number 1 Region: 291-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-44
Family ABC transporter ATPase domain-like 0.0000485
Further Details:      
 
Domain Number 2 Region: 22-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.01e-25
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 712-786
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000000693
Family Smr domain 0.006
Further Details:      
 
Weak hits

Sequence:  gi|374322955|ref|YP_005076084.1|
Domain Number - Region: 566-618
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0114
Family F1F0 ATP synthase subunit B, membrane domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374322955|ref|YP_005076084.1|
Sequence length 789
Comment MutS2 protein [Paenibacillus terrae HPL-003]
Sequence
MDSKIFKTLEYQKILNKLSHYAQTAIGQQTAQRLQPSDDLEHIKKLLKGTDEAYAADRLK
GVPSFNGVVDIIPAVKRARIGGTLSPQELLGIRTTVQAARRVQVYVASLHEENPVETLLY
WSEQLSEQRGLENSIKGCIDENAEVLDSASTELSQIRRELRSGEVRIREKLDSMIRSSTV
SKMLQDQLITIRGDRFVIPVKAEYRSYFGGIVHDQSGSGATLFIEPESIVAMNNKLRETR
LREEREIEVILQKLTALVAEQADMLLYDVDVLGTLDFIFAKARLAREMKATLPLMNDRGY
LKLKKGRHPLIPLEQVVPIDVELGNSYTSIIVTGPNTGGKTVTLKTIGLLSLMAMSGLFV
PVEDESQLCVFDAIYADIGDEQSIEQNLSTFSSHMTNIISILKNMTPKSLVLLDEVGAGT
DPAEGSALAVSILEHMHALGCRMVATTHYSELKAYAYERKGIINASMEFDVATLSPTYRL
LVGVPGRSNAFAIAERLGLPGRILDYARGEVTEEDQRVEHMIASLEQNRLTAEQEREKAE
QLRGEMEELRTRHQNELEKLEAQRERLLEKAADEARSLVDKARSEAEIIIADLRKLAQEE
GASVKEHRLIAARKELDEAEPKQRKKSAVKRPAATRTRSIVAGDEVSVHSLNKKGHVVEL
SGSKEAVVQLGIMKMKVSLDDLELLQPAQTTAPRAQKPVTGIKRTRDDNVRNELDLRGAN
VEEALMEVDRFMDEAFLANLGQVHIIHGKGTGVLRTGIQEYLRKHKHVKSYRIGNYNEGG
TGVTVAELE
Download sequence
Identical sequences G7VXV1
WP_014280580.1.37039 gi|374322955|ref|YP_005076084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]