SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374323598|ref|YP_005076727.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374323598|ref|YP_005076727.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily AF1862-like 4.71e-21
Family Cas Cmr5-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374323598|ref|YP_005076727.1|
Sequence length 125
Comment hypothetical protein HPL003_18810 [Paenibacillus terrae HPL-003]
Sequence
MKSSQHEYAQAAFEGIKSLDADSAVAKQYGQLCHRFPSLVLTNGLRLAVAFFQAKGAERP
HALYLEHMRKALALDRSWNDELRKENADYLHLSQRVLSASVWFKRYAEAILKIEQGTDTP
EQGVN
Download sequence
Identical sequences G7W4V4
gi|374323598|ref|YP_005076727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]