SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374323831|ref|YP_005076960.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374323831|ref|YP_005076960.1|
Domain Number 1 Region: 260-560
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.92e-88
Family DNA repair protein MutS, domain III 0.00000171
Further Details:      
 
Domain Number 2 Region: 562-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.8e-56
Family ABC transporter ATPase domain-like 0.00000337
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.58e-42
Family DNA repair protein MutS, domain I 0.0000305
Further Details:      
 
Domain Number 4 Region: 114-272
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.31e-28
Family DNA repair protein MutS, domain II 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374323831|ref|YP_005076960.1|
Sequence length 938
Comment DNA mismatch repair protein mutS [Paenibacillus terrae HPL-003]
Sequence
MAKYTPMIEQYLSIKDQAQDAFLFFRLGDFYEMFFDDAILASKELEITLTGREGGGTEKI
PMCGVPYHSAENYIQRLIEKGYKVAICEQMEEASATKGMVRRDIVRVVTPGTVMEGKVLG
DKSNNYMVCVTETDGMLALAACDLSTGELYVTSVPDSKEWLLDEINIYEPSEMLGDGHLL
DFVTSRMSPVGRRVVYTAWDKSKDDLVRGQFGEATWARLNEERRQCVSRLIAYLNETQKR
SLGQLTQISVYEPNHFMILDPFTRRNLELVETVRERSKKGSLLWLLDRTETSMGARLLRR
WIDKPLLSSHLIEERLEAVDKLYHQFIFREDVRAQLKEIYDLERLVGRIAFGSANARDLI
ALKLSLTRIPALRELCAESESETLRRIAQTLDSCTDLCALIEEAVADEPPISVRDGGLIK
EGYHQRLDELREASVNGKRWIAELEAKERVATGIRSLKIGYNKVFGYYIEVTKSNLASLP
EGRYERKQTLANAERYITPELKEKESLILEAEDKMVDLEYSLFSELRSKLNTEIPRLQKL
AERVAEIDVYQSLASVSAERGFVKPELTTGYDFVVEQGRHPVVEAVMKDGSFIANGTALE
EADAHILLITGPNMAGKSTYMRQVALIAIMAQIGCFVPAAHAKVPMLDRIFTRIGAADDL
IGGQSTFMVEMADIQVMTDKATPRSLIIIDELGRGTSTSEGMAIAQAVIEFVHDTIGCKA
LVSTHFHELAHLEQSLSSLRNYSMAVQESGDKVNFLRKLILGAASSSYGIYCARLAGLPD
NIIERANGLLHGFEHAAAQVTAGTEAVAVAKEKVVHRTVSGVGASYSGGTNSDQTLRESR
EAALQAPLVSQQATVVKEDTQQTVEDSSVLNHTATGVVQLSIFGEQELAPAKPQLETAEV
NPIVRQILRKVKNADVMNMTPLQAMQLLNELKNKANGL
Download sequence
Identical sequences G7W381
WP_014281437.1.37039 gi|374323831|ref|YP_005076960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]