SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374324757|ref|YP_005077886.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374324757|ref|YP_005077886.1|
Domain Number 1 Region: 629-794
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.29e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 3-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.39e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0022
Further Details:      
 
Domain Number 3 Region: 142-307
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 
Domain Number 4 Region: 516-637
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.57e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374324757|ref|YP_005077886.1|
Sequence length 810
Comment nitrite reductase [nad(p)h], large subunit [Paenibacillus terrae HPL-003]
Sequence
MNHIKKLVLVGNGMAGIRTLEHLLKIAPGVCDITVFGAEPHPNYNRIMLSSVLAGGAGLQ
DIVINDWSWYEENHIRLYTGDPVTEIDTDKRQVTSRSGVCVPYDLLLLATGSNAFILPLP
GANKEGVIGFRDIRDCETMMETAKTHKKAAVIGGGLLGLEAARGLLNLGMDVTVIHIHEH
IMDRQLDEAASLMLRRELEEQGMNFLVNKRTAAITGRRRVEGLKFADGSELEADLIVMAV
GIIPDIELAVSAGIPVNRGIIVNDYMETGIPGIYAVGECAEHRGITYGLVAPLYEQGGVL
AQRLAGMETPGYSGSVISTRLKVSGVDVFSAGCYKDESGTRSLRYQDEIGGVYKKIVIKE
EKLIGAVLFGDTSDGAKLFSLIKNGESVLGREKELLLGLTPGQSEANGSMMLEQMPDDEI
VCGCNGVSKGDIGEAVAAGCRSLGEIKACTKASASCGGCKPLVEGLLQLYAGAETGEPVK
EGICGCTTLDREAIIGGIREMGLKSVKEAMNVLGWSEPEGCTKCRPALNYYLGMVWPLDY
EDEKESRFTNERYHANIQKDGTYSVVPRIYGGVTSPADLKKIAAVAEKYNVPLVKFTGGQ
RLDLLGVKKEDLPGIWSELDMPSGHAYGKTLRTVKTCVGNTFCRFGTQDAMGMGIRLEKA
FERMNAPAKVKLAVSGCPRNCAEATIKDLGVVAIDGGWGIYVGGNGGIKVRASELLCTVK
TEDEVMEWTGAYLQYYREQANWGERTAHWVERVGLESIKQALANAETRQELVGRIEETLS
TTTDPWREIIHDKELLKNFVQLPELNSVTE
Download sequence
Identical sequences G7VPE2
gi|374324757|ref|YP_005077886.1| WP_014282351.1.37039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]