SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374325381|ref|YP_005078510.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374325381|ref|YP_005078510.1|
Domain Number 1 Region: 114-296,424-584
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.53e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000743
Further Details:      
 
Domain Number 2 Region: 293-419
Classification Level Classification E-value
Superfamily GAD domain-like 1.34e-42
Family GAD domain 0.00011
Further Details:      
 
Domain Number 3 Region: 3-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.26e-32
Family Anticodon-binding domain 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374325381|ref|YP_005078510.1|
Sequence length 592
Comment aspartyl-tRNA synthetase [Paenibacillus terrae HPL-003]
Sequence
MKRSHQCGALTHAHIGETVTLNGWVQTRRDLGGVLFIDLRDRSGIVQIVFNPAYSGDALQ
IADRVRSEYVLEVTGTVVKRDAETINANLPTGEIEVRITEIEVLNAAKTPPFFIEDGVEV
DESLRLKYRYLDLRRPEMHQTLKLRSKAAKVFRDFLDGEDFIEVETPILTKSSPEGARDY
LVPSRVHEGEFFALPQSPQIYKQLLMVGGVERYYQIARCFRDEDLRADRQPEFTQVDIET
SFMQQDDLLPMMEKLMVKLLKETIGVELETPFQRITHADAMDKYGSDKPDLRFGLELINV
NDIVASSGVKVFASVIEKGGEVKVLNAKGCGTWSRKDIDDLGPFAARYGAKGLAWIQVKE
GEFKGPIVKFFTPEEIEALKERTGAEEGDLLLFSADNKKVVADVLGALRLKIGRQLGLID
DNTFKFAWVVDFPLLGYDEDQKRYVAEHHPFTRPKDEDLALLDTEPGQVRAQAYDIVLNG
YEVGGGSMRIHKRDVQEKMFNALRLSPEEVQDKFGYLLNAFEYGAPPHGGIAFGFDRLVM
LLAGRTNLRETIAFPKTASATDLLMDAPSEVDQAQLEQLHIRLAPKPVAPKA
Download sequence
Identical sequences G7VTA7
WP_014282963.1.37039 gi|374325381|ref|YP_005078510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]