SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374322797|ref|YP_005075926.1| from Paenibacillus terrae HPL-003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374322797|ref|YP_005075926.1|
Domain Number 1 Region: 7-448
Classification Level Classification E-value
Superfamily SIS domain 1.53e-141
Family Phosphoglucose isomerase, PGI 0.000000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374322797|ref|YP_005075926.1|
Sequence length 451
Comment phosphoglucose isomerase (pgi) [Paenibacillus terrae HPL-003]
Sequence
MSKKVIFDYTKALSFVGQHEIDYFAEPIKLAHEQLHNQTGVGSDFLGWIDLPTNYDKEEF
ARIQKAAAKIQSDSEVLIVIGIGGSYLGARAAIEMLSHSFHNALPKDKRKGPAVYFAGNN
ISSTYVNHLLELIEGKDFSVNVISKSGTTTEPAIAFRVFRAALEKKYGKEEARKRIYATT
DKERGALKKLANEEGYESFIIPDDVGGRYSVLTAVGLLPIATAGINIEEMLQGAADASKE
YSNPNVAENEAYQYAAVRNALYRKGKAIEILVNYEPSLHFVSEWWKQLYGESEGKDYKGI
YPASVDFSTDLHSMGQFIQEGSRNIFETVIQVENVPSHITIEADEDDLDGLNFLAGKTVD
FVNKKAFQGTLLAHTDGQVPNLIVNIPDLSPYSFGYLAYFFEKACGISGYLLGVNPFDQP
GVEAYKKNMFALLGKPGFEEQKAELEARLSE
Download sequence
Identical sequences G7W2B9
WP_014280425.1.37039 gi|374322797|ref|YP_005075926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]